Anti-ACTH Antibody[STJ500036]
Product nameAnti-ACTH AntibodyShort DescriptionRabbit polyclonal to ACTHApplicationsIP, WBImmunogenSynthetic peptide correspo
Product nameAnti-ACTH AntibodyShort DescriptionRabbit polyclonal to ACTHApplicationsIP, WBImmunogenSynthetic peptide correspo
| Product name | Anti-ACTH Antibody[STJ500036] |
|---|---|
| Short Description | Rabbit polyclonal to ACTH |
| Applications | IP, WB |
| Immunogen | Synthetic peptide corresponding to ACTH aa 138-176. Sequence: SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF |
| Storage Instruction | Store at -20C. Avoid freeze / thaw cycles. |
| Note | For Research Use Only (RUO). |
| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Reactivity | |
| Conjugation | Unconjugated |
| Purification | Affinity Purified |
| Formulation | Tris/glycine buffer at pH 7.4 containing 0.02% sodium azide as preservative, cryo-protective agents, 0.5% stabilizing protein BSA and 30% glycerol. |
| Alternative Names | Anti-ACTH Antibody |
|---|---|
| Swiss-Prot Key | UPI00004EBE53 |
